Rekombinantný Pigg proteín aktivovaný vo vnútri usmerňovača draslíkový kanál 4

Rekombinantný Pigg proteín aktivovaný vo vnútri usmerňovača draslíkový kanál 4

€ 1.33

Obnovené

K dispozícii pre vašu objednávku

Gene Name : KCNJ5; rekombinantný g proteín aktivovaný vnútorný usmerňovač draselný kanál 4 (KCNJ5). Syn Name : Storage Buffer / / PBS p H 7,4, 50% glycerol. G proteín-aktivovaný vnútorný usmerňovač draselný kanál 4; GIRK-4; srdcový usmerňovač dovnútra. CIR. G proteín-aktivovaný vnútorný usmerňovač draselný kanál 4; CIR; GIRK-4; KATP-1; srdcový katp kanál. Zdroj : E Coli alebo kvasinky. Čistota : > 90%; * informácie o značke : jeho označené; *druh : Sus scrofa (prasa). Skladovací pufor : PBS p H 7,4, 50% glycerol; *Seq Pos : 1-419. Úložisko : Skladujte pri -20 stupňoch C. Pre rozšírené úložisko skladujte pri -20 alebo -80 stupňoch C. voľný-8 GB-USBDrive pre túto položku. Položka je určená na výskumné použitie. Nie pre diagnostický / terapeutický postup. Syn Name : CIR Heart KATP kanál dovnútra usmerňovač k (+) kanál Kir3. 4 Katp-1 draselný kanál, dovnútra usmerňujúca podrodina J člen 5; * formulár : Táto položka vyžaduje zákazkovú výrobu a dodacia lehota je medzi 5-9 týždňami. Môžeme vyrobiť na mieru podľa vašich špecifikácií.; * Nasledujúce : MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIVLLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNHAVISLRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLNQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLPGGCAGAELEAEAEQEGEDEPEGLRGSRETRDSV; * prístup# : NP_999390.1; NM_214225.1; o02670; *popis : KCNJ5; *Uniprot Zhrnutie : funkcia : Tento draslíkový kanál je riadený g proteínmi. Vnútorné usmerňovacie draslíkové kanály sa vyznačujú väčšou tendenciou umožniť draslíku prúdiť skôr do bunky ako z nej. Ich závislosť od napätia je regulovaná koncentráciou extracelulárneho draslíka; ako sa zvyšuje Vonkajší draslík, rozsah napätia otvoru kanála sa posúva na pozitívnejšie napätie. Vnútorná rektifikácia je spôsobená hlavne zablokovaním vonkajšieho prúdu vnútorným horčíkom. Môže byť blokovaný vonkajším báriom.Štruktúra podjednotky : môže sa spájať s GIRK1 a GIRK2 za vzniku heteromultimérnej jednotky tvoriacej póry aktivovanej G-proteínom. Výsledný vnútorný prúd je oveľa väčší podobnosťou.Subcelulárne umiestnenie : membrána; viacpriechodový membránový proteín. Sekvenčné podobnosti : patrí do draslíkového kanála vnútorného usmerňovača (TC 1.A. 2.1) rodina. Podrodina KCNJ5. [Zobraziť klasifikáciu].

Las mejores proposiciones en la categoría

Rekombinantný Inzulín-2 U Potkanov Obnovené
Rekombinantný Inzulín-2 U Potkanov

Gene Name : Ins2; Rekombinantný Inzulín2 (Ins2) Syn Name : skladovací pufor / / PBS p H 7,4, 50% glycerol; inzulín2 preproproteín; inzulín2; inzulín2 Inzulín2 sa štiepi do nasle

€ 22.45
Cg09 - 10ug-veľkosť: 10 mikrogramov - rekombinantný ľudský Tnfrsf21, Novoproteín vedecký-každý Obnovené
Cg09 - 10ug-veľkosť: 10 mikrogramov - rekombinantný ľudský Tnfrsf21, Novoproteín vedecký-každý

Veľkosť : 10 mikrogramov Číslo Dodávateľa : CG0910 UG Katalógové číslo VWR : 102865158 Jednotka : každý (10 mikrogramov) : CG09 1mg CG0950ug Cg0910ug Cg09500ug Novoprotein ponú

€ 2.00
13496-H08H - 100 - Veľkosť : 100 mikrogramov-Gpr37 proteín, ľudský, rekombinantný-každý Obnovené
13496-H08H - 100 - Veľkosť : 100 mikrogramov-Gpr37 proteín, ľudský, rekombinantný-každý

Veľkosť : 100 mikrogramov Číslo Dodávateľa : 13496H08 H100 Sekvencia DNA kódujúca ľudský GPR37 (NP_005293.1) prvý extracelulárny domaqin (Met 1Met 265) bol fúzovaný s polyhisti

€ 3.33
Rekombinantný ľudský Glutamátový receptor delta-2 podjednotka Obnovené
Rekombinantný ľudský Glutamátový receptor delta-2 podjednotka

Glu R delta2 podjednotka; glutamátový receptor delta2 podjednotka; Glu Rdelta2; Glur delta2 podjednotka Môžeme vyrobiť na mieru podľa vašich špecifikácií...

€ 3.73
Rekombinantný hlavný membránový proteín I Obnovené
Rekombinantný hlavný membránový proteín I

Gene Name : mmp I; ML0841; MMPI Syn Name : major membránový proteín I; Major membránový proteín I; 35 k Da antigén Druh : Mycobacterium leprae ; skladovací tlmivý roztok : tlmivý r

€ 18.53
Rekombinantný methanothermobacter thermautotrophicus 30s ribozomálny proteín s12p Obnovené
Rekombinantný methanothermobacter thermautotrophicus 30s ribozomálny proteín s12p

Gene Name : rps12p; rps12 P; rps12 Syn Name : 30s ribozomálny proteín S12 Vyrovnávacia pamäť : tlmivý roztok na báze Tris, 50% glycerol Seq Pos : 1141 Skladovanie : Skladujte pri 20 s

€ 12.27
4307-50-veľkosť : 50 mikrogramov-NT-3, myšací rekombinant, Biovízia-každá Obnovené
4307-50-veľkosť : 50 mikrogramov-NT-3, myšací rekombinant, Biovízia-každá

Veľkosť : 50 mikrogramov Číslo Dodávateľa : 430750 97% čistý Aktívny rekombinantný myšací NT3, silný neurotrofický faktor, ktorý podporuje rast a prežitie nervových a / aleb

€ 0.67
Rekombinantná Burkholderia pseudomallei Acetaldehyddehydrogenáza Obnovené
Rekombinantná Burkholderia pseudomallei Acetaldehyddehydrogenáza

Gene Name : BURPS668_A2591 Acetaldehyddehydrogenáza [acetylácia] Druh : Burkholderia pseudomallei (kmeň 668); skladovací tlmivý roztok : tlmivý roztok na báze Tris,50% glycerol Seq Po

€ 7.58
Rekombinantný Xenopus laevis histón H1.0-a Obnovené
Rekombinantný Xenopus laevis histón H1.0-a

Gene Name : h1f0a; h10; h1f0; h1fv; h1(0)1 Syn Name : histón H1.0a; histón H1.0a; H1 E; H1SB; xl H5 B; histón H5 B; histón H1(0)1 Rodina H1 histone, člen 090%; informácie o štítku :

€ 11.20
Rekombinantný Ribozomálny proteín Brucella ovis 30s S11 Obnovené
Rekombinantný Ribozomálny proteín Brucella ovis 30s S11

Gene Name : rps K Syn Name : 30s ribozomálny proteín S11 Druh : Brucella ovis (kmeň ATCC 25840 / 63 / 290 / NCTC 10512) Vyrovnávacia pamäť : tlmivý roztok na báze Tris, 50% glyce

€ 1.67
Rekombinantný Ľudský Pyrín Obnovené
Rekombinantný Ľudský Pyrín

Gene Name : MEFV; FMF; MEF; TRIM20 Syn Name : pyrínová izoforma 1; Pyrín; pyrín; marenostrín; stredomorská horúčka; Marenostrín Druh : Homo sapiens (človek); skladovací tlmivý r

€ 16.43
Rekombinantná myšacia kazeta viažuca ATP člen podskupiny D 4 Obnovené
Rekombinantná myšacia kazeta viažuca ATP člen podskupiny D 4

Nie pre diagnostický / terapeutický postup Proteíny ABC transportujú rôzne molekuly cez extra a intrabunkové membrány.2; O89016; Zhrnutie NCBI : proteín spojený s membránou kód

€ 2.33
Rekombinantný Acinetobacter sp. 3-oxoadipát enol-laktonáza 2 Obnovené
Rekombinantný Acinetobacter sp. 3-oxoadipát enol-laktonáza 2

Gene Name : cat D Betaketoadipát enollaktónhydroláza II; Enollaktónhydroláza II druh : Acinetobacter sp (kmeň ADP1); vyrovnávacia pamäť : tlmivý roztok na báze Tris,50% glycerol..

€ 2.43
Rekombinantný proteín Xenopus laevis Forkhead box A4-B Obnovené
Rekombinantný proteín Xenopus laevis Forkhead box A4-B

Gene Name : foxa4b; fkh1; XFD1; XFKH1; Fox A4a; fkh1A; foxa4b; xkfh1; pintallavis; Fox A4B; Fox A4b Syn Name : proteín forkhead box A4B; proteín Forkhead box A4B; FKH1; x FD1'; proteín fo

€ 1.00
Rekombinantný Bacillus pumilus 7-kyano-7-deazaguanínsyntáza Obnovené
Rekombinantný Bacillus pumilus 7-kyano-7-deazaguanínsyntáza

Gene Name : que C; BPUM_1263 Preq(0) syntáza; queuozínový biosyntetický proteín Que C Druh : Bacillpumil(kmeň SAFR032); skladovací tlmivý roztok : tlmivý roztok na báze Tris,50% gl

€ 2.67
Rekombinantný Ribozomálny proteín Arabidopsis thaliana 50s L9, chloroplastický Obnovené
Rekombinantný Ribozomálny proteín Arabidopsis thaliana 50s L9, chloroplastický

Gene Name : RPL9; ribozomálny proteín L9 Syn Name : 50s ribozomálny proteín L9; 50s ribozomálny proteín L9, chloroplast; CL9 Druh : Arabidopsis thaliana (žerucha myšia); skladovací

€ 1.00
Rekombinantný Bungarus multicinctus alfa-bungarotoxínová izoforma A31 Obnovené
Rekombinantný Bungarus multicinctus alfa-bungarotoxínová izoforma A31

Gene Name : AlphaBTX A31; AlphaBgt(A31); BGTX A31 Druh : Bungarmulticinct(mnohopásikový krait); skladovací pufor : pufor na báze Tris,50% glycerol Seq Pos : 2295...

€ 16.73
Rekombinantný kožný kolagén 7 Obnovené
Rekombinantný kožný kolagén 7

Gene Name : col7; C15 A11 5 Syn Name : proteín COL7; kolagén kutikuly 7 Druh : Caenorhabditis elegans; vyrovnávacia pamäť : tlmivý roztok na báze Tris, 50% glycerol Seq Pos : 35316..

€ 21.42
Rekombinantná Chlamydomonas reinhardtii svetlo nezávislá protochlorofylid reduktáza železo-síra... Obnovené
Rekombinantná Chlamydomonas reinhardtii svetlo nezávislá protochlorofylid reduktáza železo-síra...

Gene Name : chl L; DPOR podjednotka L; LIPOR podjednotka L Syn Name : podjednotka fotochlorofylid reduktázy L (chloroplast) Proteín viažuci ATP na svetlo nezávislý protochlorofylid redu

€ 16.03
Rekombinantný ľudský apolipoproteín a-IV Obnovené
Rekombinantný ľudský apolipoproteín a-IV

Gene Name : APOA4; ApoAIV; Apo AIV apolipoproteín A4 Druh : Homo sapiens (človek); skladovací tlmivý roztok : tlmivý roztok na báze Tris, 50% glycerol Seq Pos : 21396 Skladovanie : Sk

€ 1.67
Rekombinantný Bacillus pumilus Fosfopanteteín adenylyltransferáza Obnovené
Rekombinantný Bacillus pumilus Fosfopanteteín adenylyltransferáza

Gene Name : coa D; BPUM_1395; PPAT DefosfoCo A pyrofosforyláza; Panteteínfosfát adenylyltransferáza Druh : Bacillpumil(kmeň SAFR032); skladovací tlmivý roztok : tlmivý roztok na báz

€ 2.00
Rekombinantný fosfatidylcholín: ceramid cholínfosfotransferáza 4 Obnovené
Rekombinantný fosfatidylcholín: ceramid cholínfosfotransferáza 4

Gene Name : SLS4; rekombinantný fosfatidylcholín : ceramid cholínefosfotransferáza 4 (SLS4) Syn Name : Storage Buffer / / PBS p H 7,4, 50% glycerol Fosfatidylcholín : ceramid cholí

€ 9.15
Rekombinantný ľudský karcinóm / testis antigén 2 Obnovené
Rekombinantný ľudský karcinóm / testis antigén 2

Gene Name : CTAG2; CT2; ESO2; CAMEL; CT6.2; CT6.2a; CT6.2b; LAGE1; LAGE2 B; LAGE1 Syn Name : rakovina / testis antigén 2 izoforma LAGE1b; rakovina / testis antigén 2; rakovina / testis

€ 3.24
Rekombinantná Burkholderia pseudomallei 1-deoxy-D-xylulóza 5-fosfát reduktoizomeráza Obnovené
Rekombinantná Burkholderia pseudomallei 1-deoxy-D-xylulóza 5-fosfát reduktoizomeráza

Gene Name : dxr; DXP reduktoizomeráza 1deoxyxylulóza5fosfát reduktoizomeráza; 2CmetylDerytritol 4fosfát syntáza Druh : Burkholderia pseudomallei (kmeň 1106a); skladovací tlmivý rozt

€ 16.29