Rekombinantný Saccharomyces cerevisiae Manozylfosforylinozitol ceramid syntáza CSH1

Rekombinantný Saccharomyces cerevisiae Manozylfosforylinozitol ceramid syntáza CSH1

€ 2.00

Obnovené

K dispozícii pre vašu objednávku

Gene Name : CSH1. Syn Name : rekombinantná Manozylfosforylinozitol ceramid syntáza CSH1 (CSH1). Manozylfosforylinozitol ceramidsyntáza CSH1 EC= 2.-.-.- ; CSG1/SUR1 homológ 1; Csh1p. Manozylfosforylinozitol ceramidsyntáza CSH1; csg1 / SUR1 homológ 1. Zdroj : E Coli alebo kvasinky. Čistota : > 90%; * informácie o značke : jeho označené. Druh : Saccharomyces cerevisiae (kmeň ATCC 204508 / S288c) (pekárske droždie). Skladovací pufor : PBS p H 7,4, 50% glycerol; *Seq Pos : 1-376. Úložisko : Skladujte pri -20 stupňoch C. Pre rozšírené úložisko skladujte pri -20 alebo -80 stupňoch C. voľný-8 GB-USBDrive pre túto položku. Položka je určená na výskumné použitie. Nie pre diagnostický / terapeutický postup. * Formulár : Táto položka vyžaduje zákazkovú výrobu a dodacia lehota je medzi 5-9 týždňami. Môžeme vyrobiť na mieru podľa vašich špecifikácií.; * Nasledujúce : MKKELKILIIANIALLISIIHYTFDLLTLCIDDTSKDALTDEQLNPPNGFNSTFYESPPQLIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQPADYKMHNNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLCSGPFNNKRYYIQWLSDKFKLHKWKLTSSYKNKEKRRNPTRHEYNSRGKRLRKDSNIPYDSVFLDIEKNHAKFTDLT; * pristúpenie# : NP_009719.3; NM_001178509.3; P38287; *Zhrnutie Uniprot : funkcia : podieľa sa na syntéze manozylfosforylinozitol ceramidu. Katalyzuje pridanie manozylu k fosforylinozitol ceramidu. Ref.5 štruktúra podjednotky : Heterodimér CSH1 a CSG2. Ref.5subcelulárna poloha : Vakuolová membrána; viacpriechodový membránový proteín Ref.6. Rôzne : prítomný s 195 molekulami / bunkou v médiu log phase SD.Sekvenčné podobnosti : patrí do rodiny glykozyltransferázy 32.

Las mejores proposiciones en la categoría

Rekombinantná Escherichia coli vnútorná membrána aminokyselina ABC transportér permeáza proteín yecS Obnovené
Rekombinantná Escherichia coli vnútorná membrána aminokyselina ABC transportér permeáza proteín yecS

Gene Name : yec S; ECK1917; JW1903 Syn Name : rekombinantná vnútorná membrána aminoacid ABC transporter permease protein yec S (yec S) Vnútorná membrána aminokyselina ABC transportér

€ 7.49
Rekombinantný Hovädzí Serpín A3-2 Obnovené
Rekombinantný Hovädzí Serpín A3-2

Gene Name : SERPINA32 Syn Name : serpin A32; Serpin A32 Druh : Bos taur(hovädzí dobytok); skladovací tlmivý roztok : tlmivý roztok na báze Tris,50% glycerol...

€ 21.58
Rekombinantný kožný kolagén 7 Obnovené
Rekombinantný kožný kolagén 7

Gene Name : col7; C15 A11 5 Syn Name : proteín COL7; kolagén kutikuly 7 Druh : Caenorhabditis elegans; vyrovnávacia pamäť : tlmivý roztok na báze Tris, 50% glycerol...

€ 21.42
Rekombinantná Bradyrhizobium japonicum Haloalkándehalogenáza Obnovené
Rekombinantná Bradyrhizobium japonicum Haloalkándehalogenáza

Gene Name : dha A; blr1087 Druh : Bradyrhizobium japonicum (kmeň USDA 110); skladovací tlmivý roztok : tlmivý roztok na báze Tris,50% glycerol Seq Pos : 1310...

€ 22.66
Rekombinantný Bacillus pumilus 7-kyano-7-deazaguanínsyntáza Obnovené
Rekombinantný Bacillus pumilus 7-kyano-7-deazaguanínsyntáza

Gene Name : que C; BPUM_1263 Preq(0) syntáza; queuozínový biosyntetický proteín Que C Druh : Bacillpumil(kmeň SAFR032); skladovací tlmivý roztok : tlmivý roztok na báze Tris,50% gl

€ 2.67
Rekombinantný M proteín, sérotyp 2. 1 Obnovené
Rekombinantný M proteín, sérotyp 2. 1

Gene Name : emm L2.1 Syn Name : M proteín, sérotyp 2.1 Druh : Streptococcpyogenes ; skladovací pufor : tlmivý roztok na báze Tris,50% glycerol Seq Pos : 42377...

€ 2.00
Rekombinantný Saccharomyces cerevisiae pyrimidínový prekurzorový biosyntetický enzým thi5 Obnovené
Rekombinantný Saccharomyces cerevisiae pyrimidínový prekurzorový biosyntetický enzým thi5

Gene Name : THI5 Syn Name : Thi5p; pyrimidínový prekurzorový biosyntetický enzým THI5 Druh : Saccharomyces cerevisiae (kmeň ATCC 204508 / S288c) (pekárske droždie) Vyrovnávacia pa

€ 8.59
4307-50-veľkosť : 50 mikrogramov-NT-3, myšací rekombinant, Biovízia-každá Obnovené
4307-50-veľkosť : 50 mikrogramov-NT-3, myšací rekombinant, Biovízia-každá

Veľkosť : 50 mikrogramov Číslo Dodávateľa : 430750 97% čistý Aktívny rekombinantný myšací NT3, silný neurotrofický faktor, ktorý podporuje rast a prežitie nervových a / aleb

€ 0.67
Rekombinantný 30s ribozomálny proteín S19 Obnovené
Rekombinantný 30s ribozomálny proteín S19

Gene Name : rps S Druh : Herminiimonas arsenicoxydans ; skladovací tlmivý roztok : tlmivý roztok na báze Tris, 50% glycerol Seq Pos : 191 Skladovanie : Skladujte pri 20 stupňoch C, pri

€ 3.27
Rekombinantný Pigg proteín aktivovaný vo vnútri usmerňovača draslíkový kanál 4 Obnovené
Rekombinantný Pigg proteín aktivovaný vo vnútri usmerňovača draslíkový kanál 4

Gene Name : KCNJ5; rekombinantný g proteín aktivovaný vnútorný usmerňovač draselný kanál 4 (KCNJ5) Syn Name : Storage Buffer / / PBS p H 7,4, 50% glycerol G proteínaktivovaný

€ 1.33
Rekombinantný fosfatidylcholín: ceramid cholínfosfotransferáza 4 Obnovené
Rekombinantný fosfatidylcholín: ceramid cholínfosfotransferáza 4

Gene Name : SLS4; rekombinantný fosfatidylcholín : ceramid cholínefosfotransferáza 4 (SLS4) Syn Name : Storage Buffer / / PBS p H 7,4, 50% glycerol Fosfatidylcholín : ceramid cholí

€ 9.15
Rekombinantný pseudopleuronectes americanus proteín štruktúrujúci ľad A Obnovené
Rekombinantný pseudopleuronectes americanus proteín štruktúrujúci ľad A

Gene Name : ISP A Syn Name : rekombinantný proteín Štruktúrujúci ľad a; proteín štruktúrujúci ľad a; ISP A nemrznúci proteín a HPLC6; nemrznúci proteín A; HPLC6...

€ 1.67
Rekombinantná Acinetobacter baumannii DNA-riadená RNA polymerázová podjednotka alfa Obnovené
Rekombinantná Acinetobacter baumannii DNA-riadená RNA polymerázová podjednotka alfa

Gene Name : rpo A; RNAP podjednotka alfa Syn Name : DNAriadená RNA polymeráza, alfa podjednotka; DNAriadená RNA polymeráza podjednotka alfa RNA polymerázová podjednotka alfa; Transkrip

€ 2.33
Rekombinantný Ribozomálny proteín Arabidopsis thaliana 40s S6-1 Obnovené
Rekombinantný Ribozomálny proteín Arabidopsis thaliana 40s S6-1

Gene Name : RPS6 A; RPS6; F28 M20.110; F28 M20_110; ribozomálny proteín S6; RIBOZOMÁLNY proteín S6 Syn Name : 40s ribozomálny proteín S61 Druh : Arabidopsis thaliana (žerucha myšia);

€ 4.18
Rekombinantná chlórbium phaeobacteroides Antranilátfosforibozyltransferáza Obnovené
Rekombinantná chlórbium phaeobacteroides Antranilátfosforibozyltransferáza

Gene Name : trp D Druhy : Chlorobium phaeobacteroides (kmeň BS1); skladovací tlmivý roztok : tlmivý roztok na báze Tris,50% glycerol Seq Pos : 1345 Skladovanie : Skladujte pri 20 stupň

€ 2.71
Rekombinantná podjednotka Cyprinus carpio Cytochróm C oxidázy 1 Obnovené
Rekombinantná podjednotka Cyprinus carpio Cytochróm C oxidázy 1

Gene Name : COX1; Cox I; mtco1 ; coi, coxi, mtco1; coi; coxi; mtco1 Syn Name : rekombinantná podjednotka cytochrómu C oxidázy 1 (MTco1) Podjednotka cytochrómu C oxidázy 1 EC= 1.9.3.1; p

€ 1.00